PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa12g004730.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HD-ZIP
Protein Properties Length: 218aa    MW: 25124 Da    PI: 4.9597
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa12g004730.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox63.33.4e-2057110457
                     -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
        Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                     ++++t+eq++ Le  F  ++++  e++ +LA++lgL+ rqV vWFqNrRa++k+
  Csa12g004730.1  57 KRKLTDEQVNMLEMSFGDEHKLESERKDRLAAELGLDPRQVAVWFQNRRARWKN 110
                     4589************************************************95 PP

2HD-ZIP_I/II124.74.1e-4056146292
     HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                     +kr+l++eqv++LE+sF  e+kLe+erK +la eLgl+prqvavWFqnrRAR+k+k+lE++y++Lk+++d+++ +++rLe+ev +L+e+l 
  Csa12g004730.1  56 RKRKLTDEQVNMLEMSFGDEHKLESERKDRLAAELGLDPRQVAVWFQNRRARWKNKRLEEEYNKLKNSHDNVVVDKCRLESEVIQLKEQLY 146
                     8***************************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003891.0E-1954115IPR001356Homeobox domain
PROSITE profilePS5007116.58456111IPR001356Homeobox domain
CDDcd000861.31E-1656112No hitNo description
SuperFamilySSF466892.14E-1857121IPR009057Homeodomain-like
PfamPF000461.6E-1757110IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.605.9E-2158118IPR009057Homeodomain-like
PRINTSPR000319.3E-68291IPR000047Helix-turn-helix motif
PROSITE patternPS00027086109IPR017970Homeobox, conserved site
PRINTSPR000319.3E-691107IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009733Biological Processresponse to auxin
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 218 aa     Download sequence    Send to blast
MNHTVDDQNM AFISQLYPDV YTQLVPQPGD VKPPKRRRKK SKGALASGDG SNCLFRKRKL  60
TDEQVNMLEM SFGDEHKLES ERKDRLAAEL GLDPRQVAVW FQNRRARWKN KRLEEEYNKL  120
KNSHDNVVVD KCRLESEVIQ LKEQLYDAER EIQRLAERAE GGSSHSPISS SVSVEANETP  180
FFGDYKVGDD EDDYDNLFYP VPENSYIDGA EWMSLYI*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13758RKKSKGALASGDGSNCLFRKRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00473DAPTransfer from AT4G36740Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL1615891e-127AL161589.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 85.
GenBankAL1615901e-127AL161590.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 86.
GenBankCP0026871e-127CP002687.1 Arabidopsis thaliana chromosome 4 sequence.
GenBankZ997081e-127Z99708.1 Arabidopsis thaliana DNA chromosome 4, ESSA I AP2 contig fragment No. 2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010446748.11e-162PREDICTED: homeobox-leucine zipper protein ATHB-40
SwissprotO232081e-140ATB40_ARATH; Homeobox-leucine zipper protein ATHB-40
TrEMBLD7MBE61e-143D7MBE6_ARALL; Homeobox-leucine zipper protein ATHB-40
STRINGfgenesh2_kg.7__393__AT4G36740.11e-143(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM22082677
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36740.11e-120homeobox protein 40